- CNTROB Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82834
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: SQHSFQPLEP KPDLTSSTAG AFSALGAFHP DHRAERPFPE EDPGPDGEGL LKQGLPPAQL EGLKNFLHQL LETVPQNNEN
- LIP8, PP1221
- Human
- CNTROB
- 0.1 ml (also 25ul)
- Rabbit
- centrobin, centriole duplication and spindle assembly protein
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cell Cycle and Replication
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SQHSFQPLEPKPDLTSSTAGAFSALGAFHPDHRAERPFPEEDPGPDGEGLLKQGLPPAQLEGLKNFLHQLLETVPQNNEN
Specifications/Features
Available conjugates: Unconjugated